Structure of PDB 3pqy Chain J Binding Site BS01

Receptor Information

>3pqy Chain J (length=240) Species: 9606,10090 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISY
DVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSFGREQY
FGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDH
VELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNP
RNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Ligand information

>3pqy Chain H (length=10) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SSLENFRAYV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3pqy Structural basis for enabling T-cell receptor diversity within biased virus-specific CD8+ T-cell responses
Resolution	3.192 Å
Binding residue (original residue number in PDB)	E30 F108 G109
Binding residue (residue number reindexed from 1)	E30 F95 G96

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3pqy, PDBe:3pqy, PDBj:3pqy
PDBsum	3pqy
PubMed	21606376
UniProt	A0A0G2LB96; K7N5M4

[Back to BioLiP]