Structure of PDB 3j0q Chain J Binding Site BS01

Receptor Information
>3j0q Chain J (length=208) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHL
VSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINKQ
GMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQ
KIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIREF
PEYFAAQA
Ligand information
>3j0q Chain 7 (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuuguggcagucaagcguucauagcgacauugcuuuuugauucuucgau
<.<...<<<<<<...<<.......>>...>>>>>>....>.>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j0q Structure and dynamics of the Mammalian ribosomal pretranslocation complex.
Resolution10.6 Å
Binding residue
(original residue number in PDB)		R4 R7 A67 G114 M115 Y157 K158 F159 P160
Binding residue
(residue number reindexed from 1)		R2 R5 A65 G101 M102 Y144 K145 F146 P147
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:46:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3j0q', asym_id = 'J', bs = 'BS01', title = 'Structure and dynamics of the Mammalian ribosomal pretranslocation complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3j0q', asym_id='J', bs='BS01', title='Structure and dynamics of the Mammalian ribosomal pretranslocation complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '3j0q', asym_id = 'J'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='3j0q', asym_id='J')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>