Structure of PDB 3hr5 Chain J Binding Site BS01

Receptor Information
>3hr5 Chain J (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGIAWVRQAPGKGLEWVAF
ISDLAYTIYYADTVTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDN
WDAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hr5 Antibodies specific for a segment of human membrane IgE deplete IgE-producing B cells in humanized mice.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D31 S52 D53 L54 Y56 T57 Y59 D99 W101 D102
Binding residue
(residue number reindexed from 1)		D31 S52 D53 L54 Y56 T57 Y59 D99 W101 D102
External links