Structure of PDB 3cdg Chain J Binding Site BS01

Receptor Information
>3cdg Chain J (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELD
FMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYN
PNGNALDESCEDKNRYICKQQLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cdg CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence
Resolution3.4 Å
Binding residue
(original residue number in PDB)
S110 Q112 N156 N158
Binding residue
(residue number reindexed from 1)
S54 Q56 N100 N102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cdg, PDBe:3cdg, PDBj:3cdg
PDBsum3cdg
PubMed18332182
UniProtQ13241|KLRD1_HUMAN Natural killer cells antigen CD94 (Gene Name=KLRD1)

[Back to BioLiP]