Structure of PDB 3axy Chain J Binding Site BS01

Receptor Information
>3axy Chain J (length=234) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SREENVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYK
NVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDGI
LKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMV
AYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFD
EAISELDTLGEESYKDSTLIMQLLRDNLTLWTSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3axy 14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S47 K51 R58 F121 K124 R131 Y132 L176 N177 E184 L224 D227 N228
Binding residue
(residue number reindexed from 1)		S46 K50 R57 F120 K123 R130 Y131 L175 N176 E183 L223 D226 N227
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007165 signal transduction
GO:0008104 protein localization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3axy, PDBe:3axy, PDBj:3axy
PDBsum3axy
PubMed21804566
UniProtQ6ZKC0|14333_ORYSJ 14-3-3-like protein GF14-C (Gene Name=GF14C)

[Back to BioLiP]