Structure of PDB 2qux Chain J Binding Site BS01

Receptor Information
>2qux Chain J (length=123) Species: 12023 (Pseudomonas phage PP7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNG
AKTAYRVNLKLDQADVVDSGLPKVRYTQVWSHDVTIVANSTEASRKSLYD
LTKSLVATSQVEDLVVNLVPLGR
Ligand information
>2qux Chain L (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcacagaagauauggcuucgugcc
<<<<<.<<<<......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qux Structural basis for the coevolution of a viral RNA-protein complex.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		R45 N47 R54 K58 V83 S85 D87 T89 V91
Binding residue
(residue number reindexed from 1)		R47 N49 R56 K60 V79 S81 D83 T85 V87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2qux, PDBe:2qux, PDBj:2qux
PDBsum2qux
PubMed18066080
UniProtP03630|CAPSD_BPPP7 Capsid protein

[Back to BioLiP]