Structure of PDB 2qkk Chain J Binding Site BS01

Receptor Information

>2qkk Chain J (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQ
RAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTS
AGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQ
S

Ligand information

>2qkk Chain K (length=14) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacaccugauucc

..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution	3.2 Å
Binding residue (original residue number in PDB)	N210 M212 P262 G263 R278
Binding residue (residue number reindexed from 1)	N77 M79 P129 G130 R145

Enzymatic activity

Enzyme Commision number

3.1.26.4: ribonuclease H.

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0004523	RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function

External links

PDB	RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum	2qkk
PubMed	17964265
UniProt	O60930\|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]