Structure of PDB 2irf Chain J Binding Site BS01

Receptor Information

>2irf Chain J (length=109) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPL
FRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
AFRVYRMLP

Ligand information

>2irf Chain B (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagtgaaaguga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2irf Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	W638 H640 A641 K675 K678 R682 K700 R707
Binding residue (residue number reindexed from 1)	W34 H36 A37 K71 K74 R78 K96 R103
Binding affinity	PDBbind-CN: Kd=0.17uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2irf, PDBe:2irf, PDBj:2irf
PDBsum	2irf
PubMed	10487755
UniProt	P23906\|IRF2_MOUSE Interferon regulatory factor 2 (Gene Name=Irf2)

[Back to BioLiP]