Structure of PDB 2c9t Chain J Binding Site BS01

Receptor Information

>2c9t Chain J (length=205) Species: 6500 (Aplysia californica)

QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDL
VYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVL
SPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGF
EIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVV
KFRER

Ligand information

>2c9t Chain S (length=12) Species: 35631 (Conus imperialis)

GCCSDPRCAWRC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2c9t Structural Determinants of Selective {Alpha}-Conotoxin Binding to a Nicotinic Acetylcholine Receptor Homolog Achbp.
• Resolution: 2.25 Å
• Binding residue (original residue number in PDB): Q55 D75 R77 V106 T108 M114 I116 D162
• Binding residue (residue number reindexed from 1): Q55 D75 R77 V106 T108 M114 I116 D162

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:2c9t, PDBe:2c9t, PDBj:2c9t
• PDBsum: 2c9t
• PubMed: 16505382
• UniProt: Q8WSF8