Structure of PDB 1m8v Chain J Binding Site BS01

Receptor Information
>1m8v Chain J (length=71) Species: 29292 (Pyrococcus abyssi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE
VVKRYGKIVIRGDNVLAISPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m8v Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L306 D307 H310 Y334
Binding residue
(residue number reindexed from 1)		L4 D5 H8 Y32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0120114 Sm-like protein family complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m8v, PDBe:1m8v, PDBj:1m8v
PDBsum1m8v
PubMed12409299
UniProtQ9V0Y8|RUXX_PYRAB Putative snRNP Sm-like protein (Gene Name=PYRAB06500)

[Back to BioLiP]