Structure of PDB 1ggi Chain J Binding Site BS01

Receptor Information

>1ggi Chain J (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLKESGPGILQPSQTLSLTCSFSGFSLSTYGMGVSWIRQPSGKGLEWL
AHIFWDGDKRYNPSLKSRLKISKDTSNNQVFLKITSVDTADTATYYCVQE
GYIYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPE
PVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVA
HPASSTKVDKKIEPR

Ligand information

>1ggi Chain Q (length=9) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CKRIHIGPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ggi Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	H50 F52 D54 D56 R58 E95 G96 I101
Binding residue (residue number reindexed from 1)	H52 F54 D56 D58 R60 E100 G101 I103

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:1ggi, PDBe:1ggi, PDBj:1ggi
PDBsum	1ggi
PubMed	8327513
UniProt	P01863\|GCAA_MOUSE Ig gamma-2A chain C region, A allele (Gene Name=Ighg)

[Back to BioLiP]