Structure of PDB 1f9e Chain J Binding Site BS01

Receptor Information
>1f9e Chain J (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDI
LTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f9e Caspase-8 specificity probed at subsite S(4): crystal structure of the caspase-8-Z-DEVD-cho complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V338 S339 Y340 R341 N342 W348
Binding residue
(residue number reindexed from 1)		V21 S22 Y23 R24 N25 W31
Enzymatic activity
Enzyme Commision number 3.4.22.61: caspase-8.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f9e, PDBe:1f9e, PDBj:1f9e
PDBsum1f9e
PubMed10964557
UniProtQ14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]