Structure of PDB 1ea4 Chain J Binding Site BS01

Receptor Information

>1ea4 Chain J (length=44) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE

Ligand information

>1ea4 Chain U (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaccgtgcactcaatgcaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ea4 Plasmid Transcriptional Repressor Copg Oligomerises to Render Helical Superstructures Unbound and in Complexes with Oligonucleotides
Resolution	2.95 Å
Binding residue (original residue number in PDB)	R4 S29
Binding residue (residue number reindexed from 1)	R4 S29

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006276	plasmid maintenance
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ea4, PDBe:1ea4, PDBj:1ea4
PDBsum	1ea4
PubMed	11428897
UniProt	P13920\|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]