Structure of PDB 4v99 Chain Iz Binding Site BS01

Receptor Information
>4v99 Chain Iz (length=189) Species: 652599 (Panicum mosaic virus strain Kansas 109S) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGQGQGWQKLSHEEIILQVNSSTAADTIQTIPIIPRLSVPAGDKPIYSGS
APHLRTIGSAFAIHRWRALSFEWIPSCPTTTPGNLVLRFYPNYSTETPKT
LTDLMDSESLVLVPSLSGKTYRPKIETRGNPPELRNIDATAFSALSDEDK
GDYSVGRLVVGSSKQAVVIQLGLLRMRYSAEMRGATSIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v99 The crystallographic structure of Panicum Mosaic Virus (PMV).
Resolution2.9 Å
Binding residue
(original residue number in PDB)		W56 K58 S60 R116 E230
Binding residue
(residue number reindexed from 1)		W7 K9 S11 R67 E181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4v99, PDBe:4v99, PDBj:4v99
PDBsum4v99
PubMed23123270
UniProtP89036|CAPSD_PMVK Capsid protein (Gene Name=ORF3)

[Back to BioLiP]