Structure of PDB 8ppl Chain Is Binding Site BS01

Receptor Information
>8ppl Chain Is (length=159) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNF
TDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLR
RYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVT
GKRAQLRAK
Ligand information
>8ppl Chain Iw (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ppl Universal features of Nsp1-mediated translational shutdown by coronaviruses.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		T214 S249 D251 K293 R296 Q327 K331
Binding residue
(residue number reindexed from 1)		T42 S77 D79 K121 R124 Q155 K159
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
GO:0031369 translation initiation factor binding
GO:0046872 metal ion binding
Biological Process
GO:0001701 in utero embryonic development
GO:0001731 formation of translation preinitiation complex
GO:0002176 male germ cell proliferation
GO:0002183 cytoplasmic translational initiation
GO:0006412 translation
GO:0006413 translational initiation
GO:0008584 male gonad development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ppl, PDBe:8ppl, PDBj:8ppl
PDBsum8ppl
PubMed37802027
UniProtP20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 (Gene Name=EIF2S2)

[Back to BioLiP]