Structure of PDB 8qfy Chain III Binding Site BS01

Receptor Information
>8qfy Chain III (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQNSGPLSVPEGAIASLNCTYSDRRSRSFFWYRQYSGKSPELIMSIY
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVMDREYEISFG
SGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSD
VYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Ligand information
>8qfy Chain HHH (length=9) Species: 1773 (Mycobacterium tuberculosis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLPAKAPLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qfy An HLA-E-targeted TCR bispecific molecule redirects T cell immunity against Mycobacterium tuberculosis.
Resolution2.33 Å
Binding residue
(original residue number in PDB)		E96 Y97
Binding residue
(residue number reindexed from 1)		E94 Y95
External links