Structure of PDB 6wat Chain IC Binding Site BS01

Receptor Information
>6wat Chain IC (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKD
ISPAALPGEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wat Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
D36 L48 P80 A81 A82
Binding residue
(residue number reindexed from 1)
D9 L21 P53 A54 A55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wat, PDBe:6wat, PDBj:6wat
PDBsum6wat
PubMed32869745
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]