Structure of PDB 6wat Chain IA Binding Site BS01

Receptor Information
>6wat Chain IA (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKD
ISPAALPGEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wat Structural basis for histone variant H3tK27me3 recognition by PHF1 and PHF19.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R40 W41 L45 L46 Y47 F65 E66 D67 E86
Binding residue
(residue number reindexed from 1)
R13 W14 L18 L19 Y20 F38 E39 D40 E59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wat, PDBe:6wat, PDBj:6wat
PDBsum6wat
PubMed32869745
UniProtO43189|PHF1_HUMAN PHD finger protein 1 (Gene Name=PHF1)

[Back to BioLiP]