Structure of PDB 8ye4 Chain I Binding Site BS01

Receptor Information
>8ye4 Chain I (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYS
SGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVNAHSGAGSYQLT
FGKGTKLSVIPIQNPDPAVYQLRDSSDKSVCLFTDFQTNVSDVYITDKCV
LDMRSMDFKSNSAVAWSNKSDFACANAF
Ligand information
>8ye4 Chain F (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLYRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ye4 Structural insights into immune escape at killer T cell epitope by SARS-CoV-2 Spike Y453F variants.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q30 S31 N90 Y98
Binding residue
(residue number reindexed from 1)		Q29 S30 N89 Y97
External links