Structure of PDB 8trl Chain I Binding Site BS01

Receptor Information
>8trl Chain I (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTTQPPSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGL
KNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVNPANTGNQFYF
GTGTSLTVIPNIQNPDPAVYQLRDSKSSVCLFTDFDSQTNVSQSKDSDVY
ITDKCVLDMRSMDFKSNSAVAWSANAFNNSIIPEDTFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trl T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4
Resolution2.4 Å
Binding residue
(original residue number in PDB)
N36 N110
Binding residue
(residue number reindexed from 1)
N29 N93
External links