Structure of PDB 8sm5 Chain I Binding Site BS01

Receptor Information
>8sm5 Chain I (length=138) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYH
VLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFMAWCMHACRTLCCN
QSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sm5 Epstein-Barr Virus Encoded BCL2, BHRF1, Downregulates Autophagy by Noncanonical Binding of BECN1.
Resolution2.61003 Å
Binding residue
(original residue number in PDB)		N61 R71 S85 V86
Binding residue
(residue number reindexed from 1)		N60 R70 S84 V85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:8sm5, PDBe:8sm5, PDBj:8sm5
PDBsum8sm5
PubMed37776275
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]