Structure of PDB 8rg0 Chain I Binding Site BS01

Receptor Information
>8rg0 Chain I (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHG
VAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLER
Ligand information
>8rg0 Chain A (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacggccgggggcauucgcggaccagagcggcauuugccaagaauguuu
ugcgaugcggcggcguugacccgccgggcagcuaaggguggugauggcgu
ucagccaguccuuuaucauua
.<<<<..<...<<<<..<..>.......<<.>>...>>>>..>..>>>.>
.<<..<.<<<<<<.<<..>>>>>>>>.>..>>.<<..........<<<..
...>>>.....>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		G10 L11 S12 S14 A15 L16 P17 S48 V52 R55 A61 Q62 K70 D87 H90 K94 V98 H101 R104
Binding residue
(residue number reindexed from 1)		G1 L2 S3 S5 A6 L7 P8 S39 V43 R46 A52 Q53 K61 D78 H81 K85 V89 H92 R95
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtP62277|RS13_HUMAN Small ribosomal subunit protein uS15 (Gene Name=RPS13)

[Back to BioLiP]