Structure of PDB 8ozh Chain I Binding Site BS01

Receptor Information
>8ozh Chain I (length=58) Species: 2170195 (Eastern chimpanzee simian foamy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YTCCATSSRVLAWIFLVCILLIIVLVSCFVTISRIQWNKDIQVLGPVIDW
NVTQRAVY
Ligand information
>8ozh Chain B (length=11) Species: 2170195 (Eastern chimpanzee simian foamy virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLRMQHPVPKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ozh Integrated cryoEM structure of a spumaretrovirus reveals cross-kingdom evolutionary relationships and the molecular basis for assembly and virus entry
Resolution2.91 Å
Binding residue
(original residue number in PDB)		A114 Y116
Binding residue
(residue number reindexed from 1)		A56 Y58
External links