Structure of PDB 8oue Chain I Binding Site BS01

Receptor Information
>8oue Chain I (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVN
KGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKR
PTCVIMVKPHEEYQEAYDECLEEVQSLPLP
Ligand information
>8oue Chain B (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccugcggcggccgcaggaagaggaacggagcgaguccccggggcgcgauu
cccugagcugugggacgugcacccaggacucgcucacacaug
<<<<<<<<.>>>>>>>>..........<<<<<<<<<<....<<<<<<...
<<<........>>>.>>>>>.>...>>>>>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oue 2.7 angstrom cryo-EM structure of human telomerase H/ACA ribonucleoprotein.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K58 I60 R61 R62 G63 V64 K65 E66 K69 F70 K73 T85 L86 V90 K111 S120 R122 T124 C125 K130
Binding residue
(residue number reindexed from 1)		K36 I38 R39 R40 G41 V42 K43 E44 K47 F48 K51 T63 L64 V68 K89 S98 R100 T102 C103 K108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0034513 box H/ACA snoRNA binding
GO:0070034 telomerase RNA binding
Biological Process
GO:0006364 rRNA processing
GO:0007004 telomere maintenance via telomerase
GO:0031118 rRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:0042254 ribosome biogenesis
GO:0090671 telomerase RNA localization to Cajal body
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005697 telomerase holoenzyme complex
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0015030 Cajal body
GO:0031429 box H/ACA snoRNP complex
GO:0072589 box H/ACA scaRNP complex
GO:0090661 box H/ACA telomerase RNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oue, PDBe:8oue, PDBj:8oue
PDBsum8oue
PubMed38272871
UniProtQ9NX24|NHP2_HUMAN H/ACA ribonucleoprotein complex subunit 2 (Gene Name=NHP2)

[Back to BioLiP]