Structure of PDB 8hyj Chain I Binding Site BS01

Receptor Information

>8hyj Chain I (length=98) Species: 3702 (Arabidopsis thaliana)

STMKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHP
TLPRTKAVRCSKCQHREAVFFQATARGEEGMTLFFVCCNPNCGHRWRE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8hyj Chain I Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8hyj A cryo-EM structure of KTF1-bound polymerase V transcription elongation complex.
• Resolution: 4.3 Å
• Binding residue (original residue number in PDB): C7 C29 C32
• Binding residue (residue number reindexed from 1): C6 C28 C31
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000419 RNA polymerase V complex
• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005665 RNA polymerase II, core complex
• GO:0005730 nucleolus

External links

• PDB: RCSB:8hyj, PDBe:8hyj, PDBj:8hyj
• PDBsum: 8hyj
• PubMed: 37253723
• UniProt: Q6NLH0|RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A (Gene Name=NRPB9A)