Structure of PDB 8g8n Chain I Binding Site BS01

Receptor Information

>8g8n Chain I (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVLTQSPDFQSVTPKEKVTITCSANSYMYWYQQKPDQSPKLWVHGTSNLA
SGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHHWSNTQWTFGGGTKVE
IKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV
TKSFNRGEC

Ligand information

>8g8n Chain J (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CPGKGLPSC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8g8n XTX101, a tumor-activated, Fc-enhanced anti-CTLA-4 monoclonal antibody, demonstrates tumor-growth inhibition and tumor-selective pharmacodynamics in mouse models of cancer.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	W91 W96
Binding residue (residue number reindexed from 1)	W86 W91

External links

PDB	RCSB:8g8n, PDBe:8g8n, PDBj:8g8n
PDBsum	8g8n
PubMed	38164757

[Back to BioLiP]