Structure of PDB 8edg Chain I Binding Site BS01

Receptor Information
>8edg Chain I (length=74) Species: 7370 (Musca domestica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDNLEVKAKINQGLYKITPRHKGTSFIWNVLADIQKEDDTLVEGWVFCRK
CEKVLKYTTRQTSNLCRHKCCASL
Ligand information
>8edg Chain N (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agagaacaacaacaagtggcttattttgatacttatgcgccacttg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8edg Zinc-finger BED domains drive the formation of the active Hermes transpososome by asymmetric DNA binding.
Resolution4.64 Å
Binding residue
(original residue number in PDB)		K56 K59 Q64
Binding residue
(residue number reindexed from 1)		K53 K56 Q61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046872 metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8edg, PDBe:8edg, PDBj:8edg
PDBsum8edg
PubMed37491363
UniProtQ25438

[Back to BioLiP]