Structure of PDB 8e67 Chain I Binding Site BS01

Receptor Information
>8e67 Chain I (length=94) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHK
NRTNMTYEKMSRALRYYYKLNIIRKEPGQRLLFRFMKTPDEIMS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e67 The functional role of histidine within the ETV6 ETS domain
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R392 R395 Y398 R410
Binding residue
(residue number reindexed from 1)		R62 R65 Y68 R80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e67, PDBe:8e67, PDBj:8e67
PDBsum8e67
PubMed
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]