Structure of PDB 8bws Chain I Binding Site BS01

Receptor Information
>8bws Chain I (length=55) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKE
VDDVL
Ligand information
Ligand ID4QM
InChIInChI=1S/C24H42O3/c1-5-6-14(2)17-7-8-18-22-19(13-21(27)24(17,18)4)23(3)10-9-16(25)11-15(23)12-20(22)26/h14-22,25-27H,5-13H2,1-4H3/t14-,15+,16-,17-,18+,19+,20-,21+,22+,23+,24-/m1/s1
InChIKeyPFZUIDNKXWIWBG-YHEMGIGTSA-N
SMILES
SoftwareSMILES
CACTVS 3.385CCC[CH](C)[CH]1CC[CH]2[CH]3[CH](O)C[CH]4C[CH](O)CC[C]4(C)[CH]3C[CH](O)[C]12C
OpenEye OEToolkits 2.0.4CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1([C@H](C[C@H]3[C@H]2[C@@H](C[C@H]4[C@@]3(CC[C@H](C4)O)C)O)O)C
CACTVS 3.385CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C
OpenEye OEToolkits 2.0.4CCCC(C)C1CCC2C1(C(CC3C2C(CC4C3(CCC(C4)O)C)O)O)C
FormulaC24 H42 O3
Name(3R,5S,7R,8R,9S,10S,12S,13R,14S,17R)-10,13-dimethyl-17-[(2R)-pentan-2-yl]-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthrene-3,7,12-triol
ChEMBL
DrugBank
ZINCZINC000118924531
PDB chain8bws Chain I Residue 2001 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bws Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		P6 Y31 F33
Binding residue
(residue number reindexed from 1)		P6 Y31 F33
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001056 RNA polymerase III activity
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bws, PDBe:8bws, PDBj:8bws
PDBsum8bws
PubMed36977686
UniProtQ04307|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 (Gene Name=RPC11)

[Back to BioLiP]