Structure of PDB 7zxy Chain I Binding Site BS01

Receptor Information
>7zxy Chain I (length=220) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTCFL
IQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMMVL
MMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQVGY
WAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPWAI
AVLLLLHFLMIRKQGISGPL
Ligand information
>7zxy Chain P (length=29) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDILTLGWVSVLVLFTWSISMVVWGRNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		V37 N38 I39 F40
Binding residue
(residue number reindexed from 1)		V35 N36 I37 F38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum7zxy
PubMed35726684
UniProtQ57038|CYB6_SYNY3 Cytochrome b6 (Gene Name=petB)

[Back to BioLiP]