Structure of PDB 7y6p Chain I Binding Site BS01

Receptor Information

>7y6p Chain I (length=158) Species: 1902 (Streptomyces coelicolor)

MQGDPEVIEFLNEQLTAELTAINQYFLHAKLQDHKGWTKLAKYTRAESFD
EMRHAEVLTDRILLLDGLPNYQRLFHVRVGQSVTEMFQADREVELEAIDR
LRRGIEVMRAKHDITSANVFEAILADEEHHIDYLETQLDLIEKLGESLYL
STVIEQTQ

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 7y6p Chain I Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7y6p Bacterioferritin nanocage structures uncover the biomineralization process in ferritins.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): E51 E127
• Binding residue (residue number reindexed from 1): E51 E127
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0034755 iron ion transmembrane transport

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7y6p, PDBe:7y6p, PDBj:7y6p
• PDBsum: 7y6p
• PubMed: 37529551
• UniProt: Q9S2N0|BFR_STRCO Bacterioferritin (Gene Name=bfr)