Structure of PDB 7vxp Chain I Binding Site BS01

Receptor Information
>7vxp Chain I (length=97) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASATRVIQLLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHKLSN
NYYCTRDGRREAMPPSIVMSSQKTEKKAVTPAPPIKRWELSKDQPYL
Ligand information
>7vxp Chain W (length=29) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASKVKQDMPPPGGYGPIDYKRNLPRRGLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vxp The coupling mechanism of mammalian mitochondrial complex I.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R18 K40 D109
Binding residue
(residue number reindexed from 1)		R17 K39 D93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042773 ATP synthesis coupled electron transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045271 respiratory chain complex I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vxp, PDBe:7vxp, PDBj:7vxp
PDBsum7vxp
PubMed35145322
UniProtA0A8W4F7N8

[Back to BioLiP]