Structure of PDB 7vbz Chain I Binding Site BS01

Receptor Information
>7vbz Chain I (length=97) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASATRVIQLLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHKLSN
NYYCTRDGRREAMPPSIVMSSQKTEKKAVTPAPPIKRWELSKDQPYL
Ligand information
>7vbz Chain W (length=29) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASKVKQDMPPPGGYGPIDYKRNLPRRGLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vbz The coupling mechanism of mammalian mitochondrial complex I.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		W14 R18 K40 P42 D109 L113
Binding residue
(residue number reindexed from 1)		W13 R17 K39 P41 D93 L97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042773 ATP synthesis coupled electron transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0045271 respiratory chain complex I

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vbz, PDBe:7vbz, PDBj:7vbz
PDBsum7vbz
PubMed35145322
UniProtA0A4X1VLA2

[Back to BioLiP]