Structure of PDB 7ux5 Chain I Binding Site BS01

Receptor Information
>7ux5 Chain I (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAP
Ligand information
>7ux5 Chain F (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPALWQCVFAARYCYEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ux5 De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		Y32 L106 A132
Binding residue
(residue number reindexed from 1)		Y15 L89 A115
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ux5, PDBe:7ux5, PDBj:7ux5
PDBsum7ux5
PubMed36534810
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]