Structure of PDB 7tjh Chain I Binding Site BS01

Receptor Information
>7tjh Chain I (length=379) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIFLRTKALLQKSSELGALPARTAEYEQVMNFLAKAISEHRSDSLYITGP
PGTGKTAQLDMIIRQKFLQNLSWFELPDGRLESVAVTSINCISLGEPSSI
FQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYTTFVVVLDEMDRLLHANTS
ETQSVRTILELFLLAKLPTVSFVLIGMANSGLLPQTIVFQPYTAEQMYEI
VIQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEK
KIGLNYIAKVFSKFVNNNSTRTRIAKLNIQQKLILCTIIQSLKLNSDATI
DESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTKCKGKTK
RFVDKIDVDLDMREFYDEMTKISILKPFL
Ligand information
>7tjh Chain G (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacagattttatgtttagatcttttatgcttgcttttcaaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tjh A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q198 K479
Binding residue
(residue number reindexed from 1)		Q117 K346
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0003924 GTPase activity
GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 DNA replication initiation
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0033314 mitotic DNA replication checkpoint signaling
GO:0051301 cell division
GO:0140530 MCM complex loading
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0031261 DNA replication preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tjh, PDBe:7tjh, PDBj:7tjh
PDBsum7tjh
PubMed35217664
UniProtP09119|CDC6_YEAST Cell division control protein 6 (Gene Name=CDC6)

[Back to BioLiP]