Structure of PDB 7sg1 Chain I Binding Site BS01

Receptor Information
>7sg1 Chain I (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKT
KVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGGLARDMRFGAGT
RLTVKPNIQNPDPAVYVCLFTDFDSQTNVSSDVYTDKCVLDMRSMDFKSN
SAVAWS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7sg1 Structural basis of T cell receptor specificity and cross-reactivity of two HLA-DQ2.5-restricted gluten epitopes in celiac disease.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N36 G108 L109
Binding residue
(residue number reindexed from 1)		N27 G89 L90
External links