Structure of PDB 7qoj Chain I Binding Site BS01

Receptor Information
>7qoj Chain I (length=107) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKMLEISEEAITRYFTTLSQFGYKKYSDVDKIIVLFFMEEMLAGEMSYY
VTQDDYRNIVNALYCLAGSTCMIDFPMFESYDTLVHSNNRTFVPRITEDS
ILRSTED
Ligand information
>7qoj Chain K (length=19) Species: 2301731 (Bacteroides phage crAss001) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MFFTQEDYRKIEKWLLANS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qoj Structural atlas of a human gut crassvirus.
Resolution3.21 Å
Binding residue
(original residue number in PDB)		M1 Y49 V51 T52 Q53 Y56
Binding residue
(residue number reindexed from 1)		M1 Y49 V51 T52 Q53 Y56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:7qoj, PDBe:7qoj, PDBj:7qoj
PDBsum7qoj
PubMed37138077
UniProtA0A385DVM6|THB_BPCA1 Tail hub protein B (Gene Name=crAss001_39)

[Back to BioLiP]