Structure of PDB 7pkt Chain I Binding Site BS01

Receptor Information
>7pkt Chain I (length=97) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VFKTTGGRSWNPPSGLRPLSPAQRRNRTKNLALTMKNMSILKLAEANQPE
VPVRLYKPLNFSRMQWMKKKLEETRAALGWDMEARALQEQARALRVG
Ligand information
>7pkt Chain 0 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggugcucggugaaaccgagcauccaauacuaaagaaacuuuacuggcuua
guacugggaccccauuuuuaguaua
<<<<<<<<<<...>>>>>>>>>>..<<<<<<<<<<.......<<<<....
...>>>>.......>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		F11 L25 R26 L28 R36 L40 M44 M47
Binding residue
(residue number reindexed from 1)		F2 L16 R17 L19 R27 L31 M35 M38
Enzymatic activity
Enzyme Commision number ?
External links