Structure of PDB 7onb Chain I Binding Site BS01

Receptor Information
>7onb Chain I (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFK
RKYLQGKRGIEKPPFELPDFIKRTGIIDYQKLHDAFFKWQTKPKLTIHGD
LYYEGKEFETRLKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGP
PPSYPNLKIPGLNSPIPESCSFGKPLYGDVF
Ligand information
>7onb Chain F (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAARAARAAAWRAEQAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7onb Structural basis of intron selection by U2 snRNP in the presence of covalent inhibitors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
I566 Y568
Binding residue
(residue number reindexed from 1)
I77 Y79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7onb, PDBe:7onb, PDBj:7onb
PDBsum7onb
PubMed34301950
UniProtQ13435|SF3B2_HUMAN Splicing factor 3B subunit 2 (Gene Name=SF3B2)

[Back to BioLiP]