Structure of PDB 7oa6 Chain I Binding Site BS01

Receptor Information
>7oa6 Chain I (length=152) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPG
VKSKKDIDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVI
TLPDYPGVDADNIKADYANGVLTLTVPKLKPQKDGKNHVKKIEVSSQESW
GN
Ligand information
>7oa6 Chain X (length=14) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKKIEVSSQESWGN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oa6 Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		K116 K117 I121 Y123 Q125 D173 I175 A177 Y179
Binding residue
(residue number reindexed from 1)		K54 K55 I59 Y61 Q63 D111 I113 A115 Y117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0042802 identical protein binding
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0034605 cellular response to heat
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oa6, PDBe:7oa6, PDBj:7oa6
PDBsum7oa6
PubMed34795272
UniProtP15992|HSP26_YEAST Heat shock protein 26 (Gene Name=HSP26)

[Back to BioLiP]