Structure of PDB 7k75 Chain I Binding Site BS01

Receptor Information

>7k75 Chain I (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LQLQESGPGLVKPSETLSLTCSVSGESISNSAYYWAWIRQPPGKALEWIA
TVYYTGRTYHNPSLKSRVAISMDTSKNQFSLKLRSVTAADTAVYYCARTG
IVVTTPDWFDPWGPGALVTVASPTSPKVFPLSLCSTQPDGNVVIACLVQG
FFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAG
KSVTCHVKHYTNPSQDVTVPCP

Ligand information

>7k75 Chain F (length=8) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KPKHKKLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7k75 Functional human IgA targets a conserved site on malaria sporozoites.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	A33 Y34 G101 I102 V103 V104 T105
Binding residue (residue number reindexed from 1)	A32 Y33 G100 I101 V102 V103 T104

External links

PDB	RCSB:7k75, PDBe:7k75, PDBj:7k75
PDBsum	7k75
PubMed	34162751

[Back to BioLiP]