Structure of PDB 7elm Chain I Binding Site BS01

Receptor Information
>7elm Chain I (length=187) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDES
RSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQV
SRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARTLDLPFVTLRSQS
TGQHFRLFIRHGPLQATAEEGGFTCYGLSKGGFVPWF
Ligand information
>7elm Chain J (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuaagaaauucacggcgggcuugauguccgcgucuaccugguucacugcc
guguaggcag
.............................................<<<<<
.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7elm Insights into the inhibition of type I-F CRISPR-Cas system by a multifunctional anti-CRISPR protein AcrIF24.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		A18 Q19 N108 R114 R115 R119 F143 S148 Q153 H154 F155 R156 F158 T174 Y176 K180
Binding residue
(residue number reindexed from 1)		A18 Q19 N108 R114 R115 R119 F143 S148 Q153 H154 F155 R156 F158 T174 Y176 K180
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7elm, PDBe:7elm, PDBj:7elm
PDBsum7elm
PubMed35411005
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]