Structure of PDB 7dvq Chain I Binding Site BS01

Receptor Information
>7dvq Chain I (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLFDHHVQRKYREGRRPRAVKVYTINLESQYLLIQGVPAVGVMKELVERF
ALYGAIEQYNALDEYPAEDFTEVYLIKFMNLQSARTAKRKMDEQSFFGGL
LHVCYAPEFETVEETRKKLQMRKAYVVK
Ligand information
>7dvq Chain F (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uguuguaugaaaggagagaagguuagcacuccccuugacaaggauggaag
aggccggccu
............................<<<<<<<<...>>>>..>>>.>
<<<<<>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dvq Structure of the activated human minor spliceosome.
Resolution2.89 Å
Binding residue
(original residue number in PDB)		R28 G30 R31
Binding residue
(residue number reindexed from 1)		R12 G14 R15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dvq, PDBe:7dvq, PDBj:7dvq
PDBsum7dvq
PubMed33509932
UniProtQ5RL73|RBM48_HUMAN RNA-binding protein 48 (Gene Name=RBM48)

[Back to BioLiP]