Structure of PDB 7arc Chain I Binding Site BS01

Receptor Information
>7arc Chain I (length=199) Species: 37502 (Polytomella sp. Pringsheim 198.80) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTERRPGQSGAWKQVDKQRYSSEWEQDPTFKQVPKNVSEVLDDSVSVLFL
TDIVRGMMYSASGFFDDKVTILYPFEKGAVSPRFRGEHALRRYPTGEERC
ISCKLCEAICPAQAITIEAEEREDGSRKTTRYDIDMTKCIYCGFCQEACP
VDAIVEGPNFEFSTETREELLYDKQKLLENGDKWEQEIAANLRTESLYR
Ligand information
>7arc Chain q (length=28) Species: 37502 (Polytomella sp. Pringsheim 198.80) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ECYNPKGSWFNPAKRNWKKVEIWQPPQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7arc A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		R161 E198 E199 L201 Y202 D203
Binding residue
(residue number reindexed from 1)		R131 E168 E169 L171 Y172 D173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
Cellular Component
GO:0005739 mitochondrion
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7arc, PDBe:7arc, PDBj:7arc
PDBsum7arc
PubMed33768254
UniProtA0A7S0UQ60

[Back to BioLiP]