Structure of PDB 7aa9 Chain I Binding Site BS01

Receptor Information

>7aa9 Chain I (length=115) Species: 9606 (Homo sapiens)

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESVY

Ligand information

>7aa9 Chain D (length=10) Species: 9606 (Homo sapiens)

STFTNISLAD

Receptor-Ligand Complex Structure

Structure summary

Jmol._Canvas2D (Jmol) "jmolApplet0"[x]

loadScript jsmol/j2s/core/package.js

loadScript jsmol/j2s/core/corejmol.z.js

loadScript jsmol/j2s/core/corescript.z.js

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__4977271487572__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__4977271487572__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=I&pdb=7aa9","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__4977271487572__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"4977271487572","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=I&pdb=7aa9"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__4977271487572__ ready

script 1 started

script 1 started

Jmol._Canvas2D (Jmol) "jmolApplet1"[x]

loadScript jsmol/j2s/core/corebio.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__4977271487572__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__4977271487572__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=I&pdb=7aa9","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__4977271487572__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"4977271487572","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=I&pdb=7aa9"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__4977271487572__ ready

• PDB: 7aa9 Phosphorylation of the LIR Domain of SCOC Modulates ATG8 Binding Affinity and Specificity.
• Resolution: 1.72 Å
• Binding residue (original residue number in PDB): K6 P10 F11
• Binding residue (residue number reindexed from 1): K6 P10 F11

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005543 phospholipid binding
• GO:0008429 phosphatidylethanolamine binding
• GO:0030957 Tat protein binding
• GO:0031625 ubiquitin protein ligase binding
• GO:0048487 beta-tubulin binding
• GO:0050811 GABA receptor binding

Biological Process

• GO:0000045 autophagosome assembly
• GO:0000422 autophagy of mitochondrion
• GO:0006914 autophagy
• GO:0006995 cellular response to nitrogen starvation
• GO:0061723 glycophagy
• GO:0097352 autophagosome maturation

Cellular Component

• GO:0000421 autophagosome membrane
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005776 autophagosome
• GO:0005783 endoplasmic reticulum
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0016020 membrane
• GO:0030659 cytoplasmic vesicle membrane
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:7aa9, PDBe:7aa9, PDBj:7aa9
• PDBsum: 7aa9
• PubMed: 33845085
• UniProt: Q9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)

Application loaded.