Structure of PDB 6wg2 Chain I Binding Site BS01

Receptor Information
>6wg2 Chain I (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGGGVVQPGRSLRLSCAASRLTFRNFGMHWVRQTPGKGLEWVAVI
WHDGSNKFYADSVEGRFTISRDNSKNTLYLQMNSLRDEDTAIYYCAKDWG
GASDRVFDYWGRGTLVIVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKS
Ligand information
>6wg2 Chain P (length=16) Species: 5833 (Plasmodium falciparum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NPNANPNANPNANPNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wg2 Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum.
Resolution2.534 Å
Binding residue
(original residue number in PDB)		N31 F32 W52 H52A F58 G97 A99 R100B
Binding residue
(residue number reindexed from 1)		N30 F31 W51 H52 F58 G100 A102 R105
External links