Structure of PDB 6wc5 Chain I Binding Site BS01

Receptor Information

>6wc5 Chain I (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRY
KSKRQ

Ligand information

>6wc5 Chain E (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aagcactttcttaaaatagtg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6wc5 Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Y162 R168 Q187 R190 Y191 K194
Binding residue (residue number reindexed from 1)	Y21 R27 Q46 R49 Y50 K53

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6wc5, PDBe:6wc5, PDBj:6wc5
PDBsum	6wc5
PubMed	32681840
UniProt	P52952\|NKX25_HUMAN Homeobox protein Nkx-2.5 (Gene Name=NKX2-5)

[Back to BioLiP]