Structure of PDB 6wa0 Chain I Binding Site BS01

Receptor Information
>6wa0 Chain I (length=31) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPETALLVAFVAYYTALIALIFAILATRRLM
Ligand information
>6wa0 Chain G (length=28) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPETALLVAFVAYYTALIALIFAILATR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wa0 De novo designed receptor transmembrane domains enhance CAR-T cytotoxicity and attenuate cytokine release
Resolution3.484 Å
Binding residue
(original residue number in PDB)		A12 T15 A16 A19 F22 A23 A26 R29 L30
Binding residue
(residue number reindexed from 1)		A12 T15 A16 A19 F22 A23 A26 R29 L30
External links