Structure of PDB 6v92 Chain I Binding Site BS01

Receptor Information
>6v92 Chain I (length=293) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYEQEAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFF
NDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKI
HAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPKEFP
VNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNL
RARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKNWSDQEMLLLLE
GIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYIREVV
Ligand information
>6v92 Chain 2 (length=28) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v92 Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
Resolution20.0 Å
Binding residue
(original residue number in PDB)		H261 N265
Binding residue
(residue number reindexed from 1)		H186 N190
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042393 histone binding
GO:0046872 metal ion binding
Biological Process
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006325 chromatin organization
GO:0006337 nucleosome disassembly
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006368 transcription elongation by RNA polymerase II
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0016514 SWI/SNF complex
GO:0016586 RSC-type complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v92, PDBe:6v92, PDBj:6v92
PDBsum6v92
PubMed31886770
UniProtP43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 (Gene Name=RSC8)

[Back to BioLiP]