Structure of PDB 6rp9 Chain I Binding Site BS01

Receptor Information
>6rp9 Chain I (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSN
GDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCALTRGPGNQFYFGT
GTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDV
YITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rp9 TCRs with Distinct Specificity Profiles Use Different Binding Modes to Engage an Identical Peptide-HLA Complex.
Resolution3.12 Å
Binding residue
(original residue number in PDB)
P110 G113 N114
Binding residue
(residue number reindexed from 1)
P92 G93 N94
External links